| Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007695.1 | Gene: | Ifit3 / 309526 | RGDID: | 1359681 | Length: | 411 | Species: | Rattus norvegicus |
| Alignment Length: | 251 | Identity: | 51/251 - (20%) |
|---|---|---|---|
| Similarity: | 93/251 - (37%) | Gaps: | 56/251 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 616 GRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPA---AVECFQRAIKFRPNLAVAYLNLG 677
Fly 678 ISFIALGKRQQAIEI----LQAGSNLDGAAVRDRTAHDQARSSAYLQLGA-LYVEQGKLQRALAI 737
Fly 738 YREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHR----------------AALELQPNQ 786
Fly 787 VAAHLS----------YGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFL 832 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
| DUF1736 | 275..343 | CDD:285594 | |||
| TPR_11 | 602..667 | CDD:290150 | 12/53 (23%) | ||
| TPR_1 | 602..634 | CDD:278916 | 6/17 (35%) | ||
| TPR repeat | 602..630 | CDD:276809 | 6/13 (46%) | ||
| TPR repeat | 635..665 | CDD:276809 | 5/32 (16%) | ||
| TPR_11 | 636..700 | CDD:290150 | 11/70 (16%) | ||
| TPR_1 | 636..668 | CDD:278916 | 5/34 (15%) | ||
| TPR repeat | 670..694 | CDD:276809 | 3/27 (11%) | ||
| TPR_11 | 714..784 | CDD:290150 | 20/86 (23%) | ||
| TPR repeat | 715..743 | CDD:276809 | 9/28 (32%) | ||
| TPR repeat | 748..782 | CDD:276809 | 9/49 (18%) | ||
| TPR_11 | 755..819 | CDD:290150 | 18/89 (20%) | ||
| TPR repeat | 787..816 | CDD:276809 | 7/38 (18%) | ||
| TPR_11 | 821..887 | CDD:290150 | 4/12 (33%) | ||
| TPR repeat | 822..850 | CDD:276809 | 4/11 (36%) | ||
| TPR repeat | 855..885 | CDD:276809 | |||
| TPR_11 | <874..921 | CDD:290150 | |||
| TPR repeat | 890..918 | CDD:276809 | |||
| Ifit3 | NP_001007695.1 | TPR_12 | 51..126 | CDD:290160 | |
| TPR repeat | 51..79 | CDD:276809 | |||
| TPR repeat | 93..123 | CDD:276809 | |||
| TPR_12 | 94..164 | CDD:290160 | 6/13 (46%) | ||
| TPR repeat | 136..164 | CDD:276809 | 6/13 (46%) | ||
| TPR repeat | 206..236 | CDD:276809 | 4/29 (14%) | ||
| TPR_19 | 217..281 | CDD:291240 | 16/79 (20%) | ||
| TPR repeat | 241..269 | CDD:276809 | 9/27 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||