Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019924.1 | Gene: | Ifit2 / 294091 | RGDID: | 1307804 | Length: | 464 | Species: | Rattus norvegicus |
Alignment Length: | 268 | Identity: | 44/268 - (16%) |
---|---|---|---|
Similarity: | 95/268 - (35%) | Gaps: | 71/268 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 585 DW---RDEESLYRSAIAINPPKALGNLGSVLSSQGRYE-EAKQVLQEAIRFRPNMADVHFNLGIL 645
Fly 646 HQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAH 710
Fly 711 DQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLG---RLQQWDEA 772
Fly 773 ERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSR 837
Fly 838 HHESAIYH 845 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 9/65 (14%) | ||
TPR_1 | 602..634 | CDD:278916 | 5/32 (16%) | ||
TPR repeat | 602..630 | CDD:276809 | 5/28 (18%) | ||
TPR repeat | 635..665 | CDD:276809 | 3/29 (10%) | ||
TPR_11 | 636..700 | CDD:290150 | 11/63 (17%) | ||
TPR_1 | 636..668 | CDD:278916 | 3/31 (10%) | ||
TPR repeat | 670..694 | CDD:276809 | 5/23 (22%) | ||
TPR_11 | 714..784 | CDD:290150 | 11/72 (15%) | ||
TPR repeat | 715..743 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 748..782 | CDD:276809 | 5/36 (14%) | ||
TPR_11 | 755..819 | CDD:290150 | 6/66 (9%) | ||
TPR repeat | 787..816 | CDD:276809 | 1/28 (4%) | ||
TPR_11 | 821..887 | CDD:290150 | 7/25 (28%) | ||
TPR repeat | 822..850 | CDD:276809 | 6/24 (25%) | ||
TPR repeat | 855..885 | CDD:276809 | |||
TPR_11 | <874..921 | CDD:290150 | |||
TPR repeat | 890..918 | CDD:276809 | |||
Ifit2 | NP_001019924.1 | TPR_12 | 51..126 | CDD:290160 | |
TPR repeat | 96..122 | CDD:276809 | |||
TPR repeat | 127..167 | CDD:276809 | |||
TPR repeat | 242..270 | CDD:276809 | 3/27 (11%) | ||
TPR repeat | 275..325 | CDD:276809 | 12/81 (15%) | ||
TPR repeat | 330..355 | CDD:276809 | 4/24 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |