DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Ifit1bl

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_220058.2 Gene:Ifit1bl / 294090 RGDID:1304872 Length:473 Species:Rattus norvegicus


Alignment Length:449 Identity:90/449 - (20%)
Similarity:154/449 - (34%) Gaps:158/449 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 VAERLLYLPSV------------------------GFCLLV--GYGVSKLMSCNQRTRNILLLSF 568
            :||..:||..|                        |:.||.  |...::.|:|           |
  Rat   116 LAEAQIYLDKVENVCREFASPFRYRMECAEIDCEEGWALLKCGGSNCTRAMAC-----------F 169

  Fly   569 SLLL----------AAMSLRTLRRNADWRDEESL--YRSAIAINP--PKALGNLGSVLSSQGRYE 619
            :..|          |..::...|  .|:.:|.||  .|.|:.:||  |.....|...|...|:.:
  Rat   170 AKALQEEPENPEYNAGYAITAFR--MDFSNEISLEPLRKAVRLNPEDPHLKVLLALKLQDLGKQD 232

  Fly   620 EAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALG 684
            ||::.::||:...|:..::...:...::.:.....|:|..:||:|.:|:....:..:|     |.
  Rat   233 EAEKHIEEALPKIPSRNNIFGYVAKFYRRKGCVEEALEFLERALKTKPSSVYLHFQIG-----LC 292

  Fly   685 KRQQAIEILQAGSNLDGAAVRDRTAHDQA-RSS----------------AYLQLGALYVEQGKLQ 732
            .:.:..:|.:| :|:.... :||...||: ||:                ||:.|..:|.|..:.:
  Rat   293 HKSRVFQIKEA-TNMHPKG-KDRERADQSIRSAIYYFEKTLDLKPTYERAYIDLAEMYAESKQFE 355

  Fly   733 RALAIYREALSSLPGLP--QQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGI 795
            .|...:::.||.|..|.  .|:||.::     .|:.||:     |.::     .|....|...|:
  Rat   356 EAEEAFQKVLSMLSNLEVHMQQEIHFR-----YGKFQQF-----HMKS-----ENIAITHYLKGL 405

  Fly   796 TLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPNDYTLVV 860
            .:...|....:.   .|...|||..:.....|..|.|||                          
  Rat   406 KIEVTSIFRDKL---LKALQKLAERRMQQNVHVLESLSL-------------------------- 441

  Fly   861 AAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASYKAALRL 919
                                               ||.:..|.|.|..|.:.|:.||||
  Rat   442 -----------------------------------LGFVYRLKGDTRKAMSCYEKALRL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 14/64 (22%)
TPR_1 602..634 CDD:278916 8/31 (26%)
TPR repeat 602..630 CDD:276809 8/27 (30%)
TPR repeat 635..665 CDD:276809 4/29 (14%)
TPR_11 636..700 CDD:290150 11/63 (17%)
TPR_1 636..668 CDD:278916 5/31 (16%)
TPR repeat 670..694 CDD:276809 3/23 (13%)
TPR_11 714..784 CDD:290150 19/87 (22%)
TPR repeat 715..743 CDD:276809 7/43 (16%)
TPR repeat 748..782 CDD:276809 8/35 (23%)
TPR_11 755..819 CDD:290150 11/63 (17%)
TPR repeat 787..816 CDD:276809 4/28 (14%)
TPR_11 821..887 CDD:290150 5/65 (8%)
TPR repeat 822..850 CDD:276809 5/27 (19%)
TPR repeat 855..885 CDD:276809 0/29 (0%)
TPR_11 <874..921 CDD:290150 11/46 (24%)
TPR repeat 890..918 CDD:276809 8/27 (30%)
Ifit1blXP_220058.2 TPR_12 62..132 CDD:290160 5/15 (33%)
TNFRSF <124..>167 CDD:304602 5/42 (12%)
TPR repeat 144..174 CDD:276809 7/40 (18%)
TPR_11 214..280 CDD:290150 14/65 (22%)
TPR repeat 214..244 CDD:276809 8/29 (28%)
TPR repeat 282..333 CDD:276809 11/57 (19%)
TPR repeat 338..366 CDD:276809 6/27 (22%)
TPR repeat 371..406 CDD:276809 11/49 (22%)
TPR repeat 412..464 CDD:276809 17/115 (15%)
TPR_1 437..473 CDD:278916 15/90 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.