DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Uty

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_017174175.1 Gene:Uty / 22290 MGIID:894810 Length:1236 Species:Mus musculus


Alignment Length:337 Identity:66/337 - (19%)
Similarity:120/337 - (35%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 KALGNLGSVLSSQGRYEEA-----------KQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAV 656
            |||.:.....|.|..|.:|           ::|.:..:|...|.|.: :.||:::.....:..|:
Mouse   106 KALSSYQRYYSLQTDYWKAFQNHFWWWKITREVWKLLLRKFRNAAFL-YGLGLVYFYYNAFQWAI 169

  Fly   657 ECFQRAIKFRPNLAVA---YLNLGISFIALGKRQQAIEILQAG------SNLDGAAVRDRTAHDQ 712
            ..||..:...||...|   :|.||..|......:.:::..|..      ..|....::...||  
Mouse   170 RAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLKHFQLALIDCNVCTLSSVEIQFHIAH-- 232

  Fly   713 ARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQ-REILYQRIGDVLGRLQQWDEAERHH 776
                       ||..|.|...|.|.| |.|..:..||.| :..:.|::|        |    .||
Mouse   233 -----------LYETQRKYHSAKAAY-EQLLQIESLPSQVKATVLQQLG--------W----MHH 273

  Fly   777 RAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHES 841
            ...|                :..|:::...|..:.:::|:..|.....::......|...:..::
Mouse   274 NMDL----------------IGDNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDA 322

  Fly   842 AIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRT 906
            .:.:|::.:.:........:.....:..::.:||...|..||.|..|.|.|..:||.:.....:.
Mouse   323 FVSYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCNQP 387

  Fly   907 NHAAASYKAALR 918
            ..|...|..|.|
Mouse   388 QDAIKCYLNAAR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 16/74 (22%)
TPR_1 602..634 CDD:278916 9/41 (22%)
TPR repeat 602..630 CDD:276809 8/37 (22%)
TPR repeat 635..665 CDD:276809 6/29 (21%)
TPR_11 636..700 CDD:290150 14/72 (19%)
TPR_1 636..668 CDD:278916 6/31 (19%)
TPR repeat 670..694 CDD:276809 5/26 (19%)
TPR_11 714..784 CDD:290150 18/70 (26%)
TPR repeat 715..743 CDD:276809 8/27 (30%)
TPR repeat 748..782 CDD:276809 9/34 (26%)
TPR_11 755..819 CDD:290150 9/63 (14%)
TPR repeat 787..816 CDD:276809 2/28 (7%)
TPR_11 821..887 CDD:290150 8/65 (12%)
TPR repeat 822..850 CDD:276809 2/27 (7%)
TPR repeat 855..885 CDD:276809 5/29 (17%)
TPR_11 <874..921 CDD:290150 15/45 (33%)
TPR repeat 890..918 CDD:276809 7/27 (26%)
UtyXP_017174175.1 TPR repeat 88..116 CDD:276809 3/9 (33%)
TPR repeat 121..178 CDD:276809 11/57 (19%)
TPR 130..397 CDD:223533 57/309 (18%)
TPR repeat 183..213 CDD:276809 6/29 (21%)
TPR repeat 224..252 CDD:276809 11/41 (27%)
TPR repeat 262..297 CDD:276809 8/62 (13%)
TPR repeat 304..331 CDD:276809 2/26 (8%)
TPR repeat 336..366 CDD:276809 5/29 (17%)
TPR repeat 371..399 CDD:276809 7/27 (26%)
JmjC 935..999 CDD:214721
JmjC 969..1077 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.