DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and DNAAF4

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:219 Identity:49/219 - (22%)
Similarity:83/219 - (37%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 QRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAINPPKALGNL---------GSVLS 613
            :..:.|...|.:..||:.:|....||::....|.|...:|.  .|:::|::         .:.|.
Human   190 EERKKIKYKSLTRNLASRNLAPKGRNSENIFTEKLKEDSIP--APRSVGSIKINFTPRVFPTALR 252

  Fly   614 SQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQ---------------QVYPAAVECFQRAI 663
            .....||.:.:.::|...|....|:.....:..:.:               :.|.||:..:..||
Human   253 ESQVAEEEEWLHKQAEARRAMNTDIAELCDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAI 317

  Fly   664 KFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNL------DGAAVRDRTAHDQARSSAYLQLG 722
            :....:.:.|||.....:.|....:|||.......|      |.|..|.: ||.: |.:|:.|| 
Human   318 RLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALELLMPPVTDNANARMK-AHVR-RGTAFCQL- 379

  Fly   723 ALYVEQGKLQRALAIYREALSSLP 746
            .||||      .|..|..||...|
Human   380 ELYVE------GLQDYEAALKIDP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 13/88 (15%)
TPR_1 602..634 CDD:278916 7/40 (18%)
TPR repeat 602..630 CDD:276809 6/36 (17%)
TPR repeat 635..665 CDD:276809 6/44 (14%)
TPR_11 636..700 CDD:290150 14/84 (17%)
TPR_1 636..668 CDD:278916 6/46 (13%)
TPR repeat 670..694 CDD:276809 7/23 (30%)
TPR_11 714..784 CDD:290150 13/33 (39%)
TPR repeat 715..743 CDD:276809 10/27 (37%)
TPR repeat 748..782 CDD:276809
TPR_11 755..819 CDD:290150
TPR repeat 787..816 CDD:276809
TPR_11 821..887 CDD:290150
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR_11 <874..921 CDD:290150
TPR repeat 890..918 CDD:276809
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103
p23_DYX1C1_like 10..87 CDD:107226
TPR_11 289..353 CDD:290150 12/63 (19%)
TPR 1 290..323 5/32 (16%)
TPR repeat 290..318 CDD:276809 4/27 (15%)
TPR repeat 323..353 CDD:276809 7/29 (24%)
TPR 2 324..357 8/32 (25%)
TPR repeat 364..394 CDD:276809 14/38 (37%)
TPR 3 366..399 15/41 (37%)
TPR_1 367..399 CDD:278916 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.