Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011245453.1 | Gene: | Ifit3 / 15959 | MGIID: | 1101055 | Length: | 434 | Species: | Mus musculus |
Alignment Length: | 264 | Identity: | 59/264 - (22%) |
---|---|---|---|
Similarity: | 106/264 - (40%) | Gaps: | 61/264 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 616 GRYEEAKQVLQEAIRFRP-------NMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAY 673
Fly 674 LNLGISFIALGKRQQAIEILQAGSNLDG-AAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAI 737
Fly 738 YREALSSLPGLPQQREILYQRIGDVLGRLQ---QWDEAERHHRAA----LELQPNQVAAHLSYGI 795
Fly 796 TLARNSSRAS---------EAEMWFKRAL-KLAP--EQASVYHHYAEFLSLQSRHHESAIYHRRA 848
Fly 849 AELA 852 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 14/57 (25%) | ||
TPR_1 | 602..634 | CDD:278916 | 7/24 (29%) | ||
TPR repeat | 602..630 | CDD:276809 | 6/13 (46%) | ||
TPR repeat | 635..665 | CDD:276809 | 7/29 (24%) | ||
TPR_11 | 636..700 | CDD:290150 | 12/63 (19%) | ||
TPR_1 | 636..668 | CDD:278916 | 6/31 (19%) | ||
TPR repeat | 670..694 | CDD:276809 | 3/23 (13%) | ||
TPR_11 | 714..784 | CDD:290150 | 18/76 (24%) | ||
TPR repeat | 715..743 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 748..782 | CDD:276809 | 10/40 (25%) | ||
TPR_11 | 755..819 | CDD:290150 | 18/80 (23%) | ||
TPR repeat | 787..816 | CDD:276809 | 6/38 (16%) | ||
TPR_11 | 821..887 | CDD:290150 | 9/32 (28%) | ||
TPR repeat | 822..850 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 855..885 | CDD:276809 | |||
TPR_11 | <874..921 | CDD:290150 | |||
TPR repeat | 890..918 | CDD:276809 | |||
Ifit3 | XP_011245453.1 | TPR_12 | 82..157 | CDD:315987 | |
TPR repeat | 82..110 | CDD:276809 | |||
PEP_TPR_lipo | <87..>331 | CDD:274350 | 34/165 (21%) | ||
TPR repeat | 115..154 | CDD:276809 | |||
TPR repeat | 167..195 | CDD:276809 | 6/13 (46%) | ||
TPR repeat | 200..233 | CDD:276809 | 7/36 (19%) | ||
TPR repeat | 272..300 | CDD:276809 | 6/27 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |