DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Ifit1

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_032357.2 Gene:Ifit1 / 15957 MGIID:99450 Length:463 Species:Mus musculus


Alignment Length:403 Identity:82/403 - (20%)
Similarity:159/403 - (39%) Gaps:77/403 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 SLRTLRRNADWRDEESLYRSAIAINPPKALGNL-------GSVLSSQGRYEEAKQVLQE---AIR 630
            :|::|:........|.|.:.::|     ..||.       ||:..:|...::.::|.:|   ..|
Mouse    71 ALQSLKEAEALIQSEQLSKRSLA-----TWGNCAWLHYHRGSLAEAQIYLDKVEKVCKEFSSPFR 130

  Fly   631 FRPNMADVHFNLG--ILHQNQQVYPAAVECFQRAIKFRPN--------LAVAY-LNLGISFIALG 684
            :|...|::....|  :|......|..|:.||.:|:|..|.        ..||| .:|..:||:|.
Mouse   131 YRLECAEMDCEEGWALLKCGGGNYKQAMACFAKALKVEPENPEYNTGYAVVAYRQDLDDNFISLE 195

  Fly   685 KRQQAIEI--------------LQ-AGSNLDGAAVRDRTAHDQARSSAYLQLGALYV-EQGKLQR 733
            ..::|:.:              || .|.:::..|..:......:..|..::..|.|. .:.::.:
Mouse   196 PLRKAVRLNPEDPYLKVLLALKLQDLGEHVEAEAHIEEALSSTSCQSYVIRYAAKYFRRKHRVDK 260

  Fly   734 ALAIYREALSSLPG---LPQQREILYQ--------------RIGDVLGRLQQWDEAERHHRAALE 781
            ||.:...||.:.|.   |..|:.:.|:              |..|.:..|.|  :|....:..|:
Mouse   261 ALHLLNRALQASPSSGYLHYQKGLCYKQQISQLRTSRNRQPRRQDNVQELAQ--QAIHEFQETLK 323

  Fly   782 LQPNQVAAHLSYGITLARNSSRASEAEMWFKRALK----LAPEQASVYHHYAEFLSLQSRHHESA 842
            |:|....|::......| ...:..|||..|::||.    :|..:..::..|..||....:..:.|
Mouse   324 LRPTFEMAYVCMAEVQA-EIHQYEEAERNFQKALNNKTLVAHIEQDIHLRYGRFLQFHKQSEDKA 387

  Fly   843 I-YHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRT 906
            | .:.:..::....:..........::.:|:|...:...::.:|          ||.:..|.|:.
Mouse   388 ITLYLKGLKVEEKSFAWRKLLTALEKVAERRVCQNVHLVESTSL----------LGLVYKLKGQE 442

  Fly   907 NHAAASYKAALRL 919
            .:|...|:.||||
Mouse   443 KNALFYYEKALRL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 18/76 (24%)
TPR_1 602..634 CDD:278916 9/41 (22%)
TPR repeat 602..630 CDD:276809 7/37 (19%)
TPR repeat 635..665 CDD:276809 8/31 (26%)
TPR_11 636..700 CDD:290150 21/89 (24%)
TPR_1 636..668 CDD:278916 9/33 (27%)
TPR repeat 670..694 CDD:276809 8/38 (21%)
TPR_11 714..784 CDD:290150 18/87 (21%)
TPR repeat 715..743 CDD:276809 6/28 (21%)
TPR repeat 748..782 CDD:276809 9/47 (19%)
TPR_11 755..819 CDD:290150 17/81 (21%)
TPR repeat 787..816 CDD:276809 7/28 (25%)
TPR_11 821..887 CDD:290150 8/66 (12%)
TPR repeat 822..850 CDD:276809 5/28 (18%)
TPR repeat 855..885 CDD:276809 2/29 (7%)
TPR_11 <874..921 CDD:290150 11/46 (24%)
TPR repeat 890..918 CDD:276809 7/27 (26%)
Ifit1NP_032357.2 TPR 1 52..85 2/13 (15%)
TPR_12 54..124 CDD:290160 11/57 (19%)
TPR repeat 55..86 CDD:276809 2/14 (14%)
TPR repeat 91..121 CDD:276809 6/34 (18%)
TPR 2 92..126 8/38 (21%)
TPR 3 136..171 10/34 (29%)
TPR repeat 136..166 CDD:276809 8/29 (28%)
TPR_16 145..208 CDD:290168 16/62 (26%)
TPR repeat 171..203 CDD:276809 8/31 (26%)
TPR 4 174..207 8/32 (25%)
type_IV_pilW <194..354 CDD:131573 31/162 (19%)
TPR repeat 208..236 CDD:276809 4/27 (15%)
TPR 5 209..241 4/31 (13%)
TPR 6 242..275 8/32 (25%)
TPR repeat 242..270 CDD:276809 6/27 (22%)
Interaction with the 5'-triphosphate group of PPP-RNA. /evidence=ECO:0000250 247..253 2/5 (40%)
TPR repeat 275..324 CDD:276809 9/50 (18%)
TPR 7 294..328 8/35 (23%)
TPR 8 329..362 8/33 (24%)
TPR repeat 329..356 CDD:276809 6/27 (22%)
TPR 9 367..401 5/33 (15%)
TPR 10 426..459 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.