DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and TTC16

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_659402.1 Gene:TTC16 / 158248 HGNCID:26536 Length:873 Species:Homo sapiens


Alignment Length:324 Identity:68/324 - (20%)
Similarity:120/324 - (37%) Gaps:79/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 FLPASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTL 580
            ||.|.|:..:...:..|:..:......|||   .:.:..:|             |.|....|:..
Human   152 FLDALNVFSHAAELQPEKPCFRYRCMACLL---ALKQHQAC-------------LTLITNELKQD 200

  Fly   581 RRNAD------------------WRDEESLYRSAIAINP--PKALGNL-------------GSVL 612
            ..|||                  :||    ..||:.:||  |:|...|             ..:|
Human   201 TTNADVYIFRARLYNFLQKPHLCYRD----LHSALLLNPKHPQARMLLQKMVAQAQQARQDAGIL 261

  Fly   613 SSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAI------------KF 665
            :.||:.:.|.|.:..||...|....:....|.:::..|.:..|||.|.:.:            :.
Human   262 AVQGKLQHALQRINRAIENNPLDPSLFLFRGTMYRRLQEFDGAVEDFLKVLDMVTEDQEDMVRQA 326

  Fly   666 RPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGK 730
            :..|.:.|.:..:.....|..|:.:.:|       ..|:||    :|.....|:..|..:.:.|.
Human   327 QRQLLLTYNDFAVHCYRQGAYQEGVLLL-------NKALRD----EQQEKGLYINRGDCFFQLGN 380

  Fly   731 LQRALAIYREALSSLP---GLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHL 791
            |..|.|.|::||:..|   |...:..:|.:::|....|.:|:.:||.|...|:...|.:...:|
Human   381 LAFAEADYQQALALSPQDEGANTRMGLLQEKMGFCEQRRKQFQKAENHFSTAIRHNPQKAQYYL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 49/225 (22%)
TPR repeat 602..630 CDD:276809 9/40 (23%)
TPR repeat 635..665 CDD:276809 6/41 (15%)
TPR repeat 670..694 CDD:276809 3/23 (13%)
TPR repeat 715..743 CDD:276809 8/27 (30%)
TPR repeat 748..782 CDD:276809 8/33 (24%)
TPR 780..>933 CDD:440225 2/12 (17%)
TPR repeat 787..816 CDD:276809 1/5 (20%)
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
TTC16NP_659402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
TPR 1 61..94
TPR repeat 61..89 CDD:276809
LapB 64..359 CDD:442196 44/233 (19%)
TPR repeat 94..124 CDD:276809
TPR 2 96..128
TPR repeat 129..164 CDD:276809 4/11 (36%)
TPR 3 136..169 4/16 (25%)
TPR repeat 169..199 CDD:276809 7/45 (16%)
TPR repeat 204..231 CDD:276809 5/30 (17%)
TPR repeat 237..280 CDD:276809 10/42 (24%)
TPR 4 251..284 8/32 (25%)
TPR 260..454 CDD:440225 44/196 (22%)
TPR 5 285..318 6/32 (19%)
TPR repeat 285..313 CDD:276809 6/27 (22%)
TPR 6 331..364 8/43 (19%)
TPR repeat 333..359 CDD:276809 5/32 (16%)
TPR repeat 364..394 CDD:276809 9/29 (31%)
TPR 7 365..398 10/32 (31%)
TPR repeat 399..434 CDD:276809 9/34 (26%)
TPR 8 406..439 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..626
COG5099 594..>772 CDD:227430
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..873
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.