DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Ifit1bl2

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001349059.1 Gene:Ifit1bl2 / 112419 MGIID:2148249 Length:466 Species:Mus musculus


Alignment Length:413 Identity:87/413 - (21%)
Similarity:158/413 - (38%) Gaps:102/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 SLRTLRRNADWRDEESLYRSAIAINPPKALGNL-------GSVLSSQGRYEEAKQVLQE---AIR 630
            :|::|:........|.|.:.::|     ..||.       ||:..:|...::.::|.:|   ..|
Mouse    79 ALQSLKEAEALIQSEQLSKRSLA-----TWGNCAWLHYHRGSLAEAQVYLDKVEKVCKEFSSPFR 138

  Fly   631 FRPNMADVHFNLG--ILHQNQQVYPAAVECFQRAIKFRP-----NLAVAYLNLGISFI---ALGK 685
            :|...|::....|  :.....|.|..|:.||:||:|..|     |...|.:...:.:.   :|..
Mouse   139 YRLECAEMDCEEGWALRKCGSQNYTRAMACFERALKVEPENPEYNAGYADVAYHLDYYDGNSLQP 203

  Fly   686 RQQAIEI--------------LQAGSNLDGAA--VRDRTAHDQARSSAYLQLGALYVEQGKLQRA 734
            .::|:.:              ||.....|.|.  :::.|....::::.:..:...|..:|.::.|
Mouse   204 LKKAVSVKPEDPYLKVLLALKLQDLRKTDEAEKHIKEATLTISSQNNIFGYVAKFYRRKGCVEEA 268

  Fly   735 LAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAER-------------------HHRAAL 780
            |...::||.:.|..|    .|:.:||  |....|:.:.::                   |.:..|
Mouse   269 LGFLKKALETKPSSP----YLHFQIG--LCHKTQFFQMKKATSRENRKRADQSCHLAICHFKKTL 327

  Fly   781 ELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAP----EQASVYHHYAEFLSLQSRHHES 841
            ||:|....|::......|:|..: .|||..|:..|.::.    .|..::..|..|.....:..|:
Mouse   328 ELKPTYDRAYIDLAEVYAKNHQQ-KEAEDNFQEVLSMSNLGDYMQQEIHFRYGNFQQYYKKSEEA 391

  Fly   842 AIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYR----KAV-ALRPGDAHAH-----TNL 896
            ||.|                     .|...|::....||    ||: .|..|....|     :.|
Mouse   392 AITH---------------------YLKGLKIEVTSHYRDKLLKALEELAEGRKEDHVLESLSLL 435

  Fly   897 GAILHLLGRTNHAAASYKAALRL 919
            |.:..|.|.|:.|.:.|:.||||
Mouse   436 GLVCRLRGDTSEAMSCYEKALRL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 19/76 (25%)
TPR_1 602..634 CDD:278916 9/41 (22%)
TPR repeat 602..630 CDD:276809 7/37 (19%)
TPR repeat 635..665 CDD:276809 9/31 (29%)
TPR_11 636..700 CDD:290150 17/87 (20%)
TPR_1 636..668 CDD:278916 11/38 (29%)
TPR repeat 670..694 CDD:276809 3/40 (8%)
TPR_11 714..784 CDD:290150 17/88 (19%)
TPR repeat 715..743 CDD:276809 5/27 (19%)
TPR repeat 748..782 CDD:276809 8/52 (15%)
TPR_11 755..819 CDD:290150 18/82 (22%)
TPR repeat 787..816 CDD:276809 7/28 (25%)
TPR_11 821..887 CDD:290150 14/70 (20%)
TPR repeat 822..850 CDD:276809 6/27 (22%)
TPR repeat 855..885 CDD:276809 6/34 (18%)
TPR_11 <874..921 CDD:290150 18/56 (32%)
TPR repeat 890..918 CDD:276809 9/32 (28%)
Ifit1bl2NP_001349059.1 TPR_11 <63..>353 CDD:330823 55/285 (19%)
TPR repeat 63..94 CDD:276809 2/14 (14%)
TPR repeat 99..129 CDD:276809 6/34 (18%)
TPR repeat 144..174 CDD:276809 9/29 (31%)
TPR repeat 179..210 CDD:276809 4/30 (13%)
TPR repeat 215..241 CDD:276809 4/25 (16%)
TPR repeat 282..329 CDD:276809 8/52 (15%)
TPR_11 <324..>458 CDD:330823 37/155 (24%)
TPR repeat 334..362 CDD:276809 7/28 (25%)
TPR repeat 372..401 CDD:276809 7/49 (14%)
TPR repeat 429..457 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.