| Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
| Alignment Length: | 331 | Identity: | 73/331 - (22%) |
|---|---|---|---|
| Similarity: | 109/331 - (32%) | Gaps: | 109/331 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 582 RNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYE-EAKQVLQEAIRFRPNMADVHFNLGIL 645
Fly 646 HQNQQVYPAAVECFQ---RAIKFRPNLAVAYLNLGISFIALGKRQQAI----EILQAGSNLDGAA 703
Fly 704 VRDRTAHDQARSSAYLQLGALYVEQ-GKLQRAL-----AIYREALSSLPGLPQQREILYQRIGDV 762
Fly 763 LGRLQQWDE--AERHHRAALELQPNQVAAHLSYGITLARNS-SRASEAEMWFKRALKLAPEQAS- 823
Fly 824 ---------VYHHYAEFLSLQSRHHESAIYHRRA-AELAPNDYTLVVAAATAMRLLDRKVDAEMW 878
Fly 879 YRKAVA 884 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
| DUF1736 | 275..343 | CDD:285594 | |||
| TPR_11 | 602..667 | CDD:290150 | 13/68 (19%) | ||
| TPR_1 | 602..634 | CDD:278916 | 7/32 (22%) | ||
| TPR repeat | 602..630 | CDD:276809 | 7/28 (25%) | ||
| TPR repeat | 635..665 | CDD:276809 | 5/32 (16%) | ||
| TPR_11 | 636..700 | CDD:290150 | 14/70 (20%) | ||
| TPR_1 | 636..668 | CDD:278916 | 5/34 (15%) | ||
| TPR repeat | 670..694 | CDD:276809 | 5/27 (19%) | ||
| TPR_11 | 714..784 | CDD:290150 | 13/77 (17%) | ||
| TPR repeat | 715..743 | CDD:276809 | 6/33 (18%) | ||
| TPR repeat | 748..782 | CDD:276809 | 4/35 (11%) | ||
| TPR_11 | 755..819 | CDD:290150 | 12/66 (18%) | ||
| TPR repeat | 787..816 | CDD:276809 | 7/29 (24%) | ||
| TPR_11 | 821..887 | CDD:290150 | 22/75 (29%) | ||
| TPR repeat | 822..850 | CDD:276809 | 10/38 (26%) | ||
| TPR repeat | 855..885 | CDD:276809 | 11/30 (37%) | ||
| TPR_11 | <874..921 | CDD:290150 | 4/11 (36%) | ||
| TPR repeat | 890..918 | CDD:276809 | |||
| TOMM34 | NP_006800.2 | TPR 1 | 9..42 | 7/32 (22%) | |
| TPR repeat | 9..37 | CDD:276809 | 5/27 (19%) | ||
| PLN03088 | <12..>294 | CDD:330826 | 73/331 (22%) | ||
| TPR repeat | 50..80 | CDD:276809 | 8/45 (18%) | ||
| TPR 2 | 51..84 | 9/48 (19%) | |||
| TPR repeat | 85..113 | CDD:276809 | 5/27 (19%) | ||
| TPR 3 | 86..118 | 7/31 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 7/36 (19%) | |||
| TPR 4 | 193..226 | 8/37 (22%) | |||
| TPR repeat | 193..221 | CDD:276809 | 7/32 (22%) | ||
| TPR repeat | 226..256 | CDD:276809 | 11/29 (38%) | ||
| TPR 5 | 227..260 | 13/33 (39%) | |||
| TPR repeat | 261..289 | CDD:276809 | 4/10 (40%) | ||
| TPR 6 | 262..294 | 4/9 (44%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||