Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780534.1 | Gene: | Bbs4 / 102774 | MGIID: | 2143311 | Length: | 520 | Species: | Mus musculus |
Alignment Length: | 508 | Identity: | 98/508 - (19%) |
---|---|---|---|
Similarity: | 166/508 - (32%) | Gaps: | 160/508 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 515 PFLPASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRT 579
Fly 580 LRRNADWRDEESL-YRSAIAINPPKALGNLGSVLSS---QGRYEEAKQVLQEAIRFRPNMADVHF 640
Fly 641 NLGI---------------------------------LHQNQQVYPAAVECFQRAIKFRPNLAVA 672
Fly 673 YLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAI 737
Fly 738 YREALSSLP---------GL----------------------PQQREILYQRIGDVLGRLQQWDE 771
Fly 772 AERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQS 836
Fly 837 RHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVD--------------AEMWYRKAVALRP 887
Fly 888 GDAHAHTN-----------------------LGAILHLLGRTNHAAASYKAAL 917 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 19/100 (19%) | ||
TPR_1 | 602..634 | CDD:278916 | 10/34 (29%) | ||
TPR repeat | 602..630 | CDD:276809 | 10/30 (33%) | ||
TPR repeat | 635..665 | CDD:276809 | 8/62 (13%) | ||
TPR_11 | 636..700 | CDD:290150 | 18/96 (19%) | ||
TPR_1 | 636..668 | CDD:278916 | 9/64 (14%) | ||
TPR repeat | 670..694 | CDD:276809 | 7/23 (30%) | ||
TPR_11 | 714..784 | CDD:290150 | 21/100 (21%) | ||
TPR repeat | 715..743 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 748..782 | CDD:276809 | 11/55 (20%) | ||
TPR_11 | 755..819 | CDD:290150 | 16/63 (25%) | ||
TPR repeat | 787..816 | CDD:276809 | 4/28 (14%) | ||
TPR_11 | 821..887 | CDD:290150 | 11/79 (14%) | ||
TPR repeat | 822..850 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 855..885 | CDD:276809 | 4/43 (9%) | ||
TPR_11 | <874..921 | CDD:290150 | 16/81 (20%) | ||
TPR repeat | 890..918 | CDD:276809 | 11/51 (22%) | ||
Bbs4 | NP_780534.1 | Required for localization to centrosomes. /evidence=ECO:0000250 | 1..66 | 6/50 (12%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||||
TPR 1 | 67..100 | 9/37 (24%) | |||
TPR repeat | 68..95 | CDD:276809 | 7/31 (23%) | ||
Interaction with PCM1. /evidence=ECO:0000250 | 101..337 | 54/247 (22%) | |||
TPR_11 | 101..166 | CDD:290150 | 12/64 (19%) | ||
TPR repeat | 101..129 | CDD:276809 | 9/27 (33%) | ||
TPR repeat | 134..164 | CDD:276809 | 3/29 (10%) | ||
TPR_11 | 136..199 | CDD:290150 | 9/62 (15%) | ||
TPR_11 | 169..233 | CDD:290150 | 17/74 (23%) | ||
TPR repeat | 169..196 | CDD:276809 | 5/26 (19%) | ||
TPR | 170..201 | CDD:197478 | 7/30 (23%) | ||
TPR repeat | 202..229 | CDD:276809 | 9/33 (27%) | ||
TPR repeat | 236..264 | CDD:276809 | 8/27 (30%) | ||
TPR_11 | 237..301 | CDD:290150 | 10/63 (16%) | ||
TPR repeat | 270..298 | CDD:276809 | 1/27 (4%) | ||
TPR_11 | 272..335 | CDD:290150 | 12/63 (19%) | ||
TPR repeat | 303..333 | CDD:276809 | 10/30 (33%) | ||
TPR_11 | 305..369 | CDD:290150 | 17/65 (26%) | ||
Required for localization to centrosomes. /evidence=ECO:0000250 | 338..520 | 28/168 (17%) | |||
TPR repeat | 338..366 | CDD:276809 | 4/28 (14%) | ||
TPR_16 | 342..400 | CDD:290168 | 10/79 (13%) | ||
TPR repeat | 372..397 | CDD:276809 | 5/24 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 488..520 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |