DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4341 and ttc32

DIOPT Version :9

Sequence 1:	NP_608558.1	Gene:	CG4341 / 33276	FlyBaseID:	FBgn0028481	Length:	938	Species:	Drosophila melanogaster
Sequence 2:	NP_001020691.1	Gene:	ttc32 / 100004012	ZFINID:	ZDB-GENE-041014-158	Length:	136	Species:	Danio rerio

Alignment Length:	115	Identity:	30/115 - (26%)
Similarity:	47/115 - (40%)	Gaps:	27/115 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   709 AHDQARSSAYLQLGALYVE----------------------QGKLQRALAIYREAL---SSLPGL 748
            ||::..|..|.:...||.:                      :|:::.....:.||:   :|...:
Zfish    12 AHEEFNSKNYKRAEELYTQFIESCTKSRDCNGQDLAIAYNNRGQVKYLRVDFYEAMDDYTSAIHI 76

  Fly   749 PQQREI-LYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITL 797
            .:|.|: ||.| |.:..||..:.|||...|..|||.|:...|..|...||
Zfish    77 NRQFEVPLYNR-GLIRYRLGFFKEAEGDFRRVLELNPDFKDAKESLNQTL 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4341	NP_608558.1	PMT_2	112..>232	CDD:304453
		DUF1736	275..343	CDD:285594
		TPR_11	602..667	CDD:290150
		TPR_1	602..634	CDD:278916
		TPR repeat	602..630	CDD:276809
		TPR repeat	635..665	CDD:276809
		TPR_11	636..700	CDD:290150
		TPR_1	636..668	CDD:278916
		TPR repeat	670..694	CDD:276809
		TPR_11	714..784	CDD:290150	23/95 (24%)
		TPR repeat	715..743	CDD:276809	7/52 (13%)
		TPR repeat	748..782	CDD:276809	13/34 (38%)
		TPR_11	755..819	CDD:290150	18/43 (42%)
		TPR repeat	787..816	CDD:276809	4/11 (36%)
		TPR_11	821..887	CDD:290150
		TPR repeat	822..850	CDD:276809
		TPR repeat	855..885	CDD:276809
		TPR_11	<874..921	CDD:290150
		TPR repeat	890..918	CDD:276809
ttc32	NP_001020691.1	TPR_11	9..77	CDD:290150	10/64 (16%)
		TPR repeat	9..33	CDD:276809	6/20 (30%)
		TPR repeat	46..76	CDD:276809	4/29 (14%)
		TPR_11	47..112	CDD:290150	19/65 (29%)
		TPR repeat	81..109	CDD:276809	11/28 (39%)
		TPR_1	84..114	CDD:278916	14/30 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900