DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and ifit11

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001177393.1 Gene:ifit11 / 100001239 ZFINID:ZDB-GENE-121214-302 Length:483 Species:Danio rerio


Alignment Length:365 Identity:76/365 - (20%)
Similarity:126/365 - (34%) Gaps:93/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 PKALGNLG--SVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIK 664
            |:.||..|  .:..|...|:.|.:..|:|:...|..::  :|.|        |..|:...:.|:.
Zfish   137 PEVLGEKGWAYLKFSYKYYDRAVEAFQKAVELDPENSE--WNAG--------YATALYRIETALN 191

  Fly   665 -FRPNL---------AVAYLNLGISF--------IALGKR--QQAIEILQAGSNLDGAAVRDRTA 709
             ||..:         |:..|.|.||.        ..||.|  ..:.::::....|...|:.....
Zfish   192 PFRTEMDTPCIVDSPAIKQLRLAISINPDDDSLRALLGLRLFLCSKKLMKESEKLMETALNGSPE 256

  Fly   710 HDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPG---LPQQREILYQRIGDVLGRLQQWDE 771
            |...  :.|  :...:..||.:.|::.:...||...|.   :..|..:.|:.....|    |.::
Zfish   257 HPHV--TRY--VAKFFRNQGSVDRSIELLETALQKSPNSGFIHHQLAMCYKTKKIDL----QKEK 313

  Fly   772 AERHH------------RAALELQPNQVAA----HLSYGITLARNSSRASEAEMWFKRALKLAPE 820
            .:||.            ..|..|:.:.:.|    .:.||     .....|:||..||:....|.|
Zfish   314 GDRHQINNARNQCIYYLEKATSLKDSFIIAMCELAMQYG-----EKHELSKAEGLFKKTFITAKE 373

  Fly   821 QASVYH----HYAEFLSLQSRHHESAIYH-RRAAELAPND-------YTLVVAAATAMRLLDRKV 873
            :....|    :||||....:|....||.| ::...:.|:.       |.|:..|           
Zfish   374 KNECIHIVHCYYAEFQQYSNRCELLAIEHYKKCLTMNPDSSEGNRSAYKLMNIA----------- 427

  Fly   874 DAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASY 913
                  :|.:...|.:..||..||.|....|.......||
Zfish   428 ------KKHLKANPNNWDAHEILGLIYQKKGEMFGDTKSY 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 16/67 (24%)
TPR_1 602..634 CDD:278916 9/33 (27%)
TPR repeat 602..630 CDD:276809 9/29 (31%)
TPR repeat 635..665 CDD:276809 5/30 (17%)
TPR_11 636..700 CDD:290150 15/83 (18%)
TPR_1 636..668 CDD:278916 7/32 (22%)
TPR repeat 670..694 CDD:276809 8/33 (24%)
TPR_11 714..784 CDD:290150 15/84 (18%)
TPR repeat 715..743 CDD:276809 5/27 (19%)
TPR repeat 748..782 CDD:276809 7/45 (16%)
TPR_11 755..819 CDD:290150 15/79 (19%)
TPR repeat 787..816 CDD:276809 8/32 (25%)
TPR_11 821..887 CDD:290150 14/77 (18%)
TPR repeat 822..850 CDD:276809 9/32 (28%)
TPR repeat 855..885 CDD:276809 4/36 (11%)
TPR_11 <874..921 CDD:290150 10/40 (25%)
TPR repeat 890..918 CDD:276809 8/24 (33%)
ifit11NP_001177393.1 TPR_12 54..129 CDD:290160
TPR repeat 55..83 CDD:276809
TPR repeat 97..127 CDD:276809
TPR_2 137..172 CDD:285020 10/34 (29%)
TPR repeat 137..167 CDD:276809 9/29 (31%)
TPR repeat 172..217 CDD:276809 11/54 (20%)
TPR repeat 224..251 CDD:276809 4/26 (15%)
TPR repeat 291..336 CDD:276809 7/48 (15%)
TPR repeat 341..366 CDD:276809 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.