DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIC and Ir41a

DIOPT Version :10

Sequence 1:NP_608557.4 Gene:GluRIIC / 33275 FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:382 Identity:69/382 - (18%)
Similarity:129/382 - (33%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 PPY----FSYNETARELNLTGNALYQGYAVDLIDAIARHVGFEYVFVPVADQQYG---KLDKE-T 487
            |||    .:.:..|:::.::|.:.::...:|         |.|...|....:|:.   ::|.. .
  Fly   221 PPYTVIKHNMSTNAQDMGVSGESDFKNVYID---------GTETRIVLNFCEQFNCTIQIDSSAA 276

  Fly   488 KQW---------NGIIGEIINNDAHMGICDLTITQARKTAVDFTVPFMQLGVSILAYKSPHVEKT 543
            ..|         :|.:|.:||..|.:.|..:.......|.:|.::..::.|::.|.   |...:.
  Fly   277 NDWGKVYPNMSGDGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLV---PAPLRL 338

  Fly   544 LDAY--LAPFGGEVWIWILISVFVMTFLKTIVARISKMDWENPHPCNRDPEVLENQWRIHNTGWL 606
            ...|  |.||...:|..||:.:                       |            ...|| |
  Fly   339 TSWYLPLEPFKETLWAAILLCL-----------------------C------------AEATG-L 367

  Fly   607 TVASIMTAGCDILPRSPQVRMFEATWW---------IFAIIIANSYTANLAAFLTSSKMEGSIAN 662
            .:|........:||.      :...||         .|.:.|:.|  .|..|:..:.::......
  Fly   368 VLAYKSEQALYVLPG------YREGWWTCTSFGVCTTFKLFISQS--GNSKAYSLTVRVLLFACF 424

  Fly   663 LKDLSAQKKVKFGTIYGGSTYNLLA-----DSNETVYRLAFNLM----NND--------DPSAYT 710
            |.||.      ..:||||...::|.     ::.:||.||.|:.:    |::        ...|..
  Fly   425 LNDLI------ITSIYGGGLASILTIPSMDEAADTVTRLRFHRLQWAANSEAWVSAIRASDEALV 483

  Fly   711 KDNLEGVDRVRKNRGDYMFLMETTTLEYHREQNCDLRSVGEKFGEKHYAIAVPFGAE 767
            ||.|.          ::....:...|...::|:..:....|:....|:||....|.:
  Fly   484 KDILY----------NFHIYSDDELLRLAQDQHMRIGFTVERLPFGHFAIGNYLGPQ 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIICNP_608557.4 Periplasmic_Binding_Protein_type1 26..409 CDD:471960
PBP2_iGluR_Kainate 423..794 CDD:270432 69/382 (18%)
Lig_chan 554..827 CDD:459656 42/240 (18%)
Ir41aNP_995744.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.