DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIC and glr-8

DIOPT Version :9

Sequence 1:NP_608557.4 Gene:GluRIIC / 33275 FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_001368711.1 Gene:glr-8 / 180924 WormBaseID:WBGene00001619 Length:547 Species:Caenorhabditis elegans


Alignment Length:437 Identity:92/437 - (21%)
Similarity:166/437 - (37%) Gaps:50/437 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 VATRIGPPYFSYNETARELNLTGNALYQGYAVDLIDAIARHVGFEYVFVPVADQQYGKLDKETKQ 489
            |...|.|||.:|...: :..:|......|..::::..|.:.:...|..:|.....:|  :.....
 Worm    67 VVPAIEPPYVNYVNFS-DAAVTDKGYGPGVVMEILKEIGKRLNLTYEILPALGSTWG--EYLNGS 128

  Fly   490 WNGIIGEIINNDAHMGICDLTITQARKTAVDFTVPFM--QLGVSILAYKSP--HVEKTLDAYLAP 550
            |.|..|:::..:..:......:...|....|.|.||.  ..|:.|   :||  :.:.||.....|
 Worm   129 WTGAFGQLVRGEVDLLAGGAIMEYDRSVIADLTYPFQFEPTGIMI---RSPEKYEDDTLLIVTEP 190

  Fly   551 FGGEVWI----WILISVFVMTFLKTIVARISKMDWENPHPCNRDPEVLENQWRIHNTGWLTVASI 611
            |..|||:    .||||..:...:..|:.::.:.....|                ..:.|:..:..
 Worm   191 FSWEVWVITAAVILISGVIFLVMTNIIRKVYEEMTVTP----------------FESIWVFFSIF 239

  Fly   612 MTAGCDILPRSPQVRMFEATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDL-SAQKKVKFG 675
            :..|....|||...|:..|.||:.:|.::.::|.:|.|.....|......|:..| ...|:.||.
 Worm   240 VQQGLPEQPRSWSCRVLVALWWLASITLSATFTGSLVALFAVDKTNVPFQNIDQLVRLVKQGKFE 304

  Fly   676 TIYGGSTY---NLLADSNETVYRLAFNLMNNDDPSAYTKDNLEGVDRVRKNRGDYMFLMETTTLE 737
            .:...:::   .::|.|...|||..::.|..:....|......||..||.|.| |..|....||.
 Worm   305 IVMDENSFTRTEMIARSKLPVYRDLWHEMIVNHKVKYVNGIARGVAFVRANPG-YALLGPMATLN 368

  Fly   738 YHREQNCDLRSVGEKFGEKHYAIAVPFGAEYRSNLSVAILKLSERGELYDLKQKW---------W 793
            ::...:|.:....:.....:.:|.:...:.|....|..|.::.|||    ..|||         .
 Worm   369 FYAYSDCKVILFNDGILPVYLSIPLVKNSIYSPYFSTKIREMVERG----FTQKWIADYRSYVAM 429

  Fly   794 KNPNASCFEEPDPDATPDMTFEELRGIFYTLYAGILIAFLIGITEFL 840
            :..|........|.:..|:  :..:|.|:....|..:...:.:.||:
 Worm   430 QKINECNSTTIGPKSYLDL--KRAQGAFWVFLGGAGLGLALFVGEFI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIICNP_608557.4 PBP1_iGluR_Kainate 26..404 CDD:107377
Periplasmic_Binding_Protein_Type_1 <279..363 CDD:299141
PBP2_iGluR_Kainate 423..794 CDD:270432 84/389 (22%)
Lig_chan 554..828 CDD:278489 61/290 (21%)
glr-8NP_001368711.1 PBP2_iGluR_ligand_binding 62..424 CDD:270219 84/383 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.