DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CPR2

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:82/167 - (49%)
Similarity:113/167 - (67%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            :|.:::.|::|.::.||||..||:||:.|||..||..:.....:...::||.||||:..|:||||
Yeast    34 ITQKVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGG 98

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTV-GAKWLDGKHT 153
            |..:|.|.|..|||||.||||:  ..::|:|.|.|.|||||.||||.||::||. .|.||||||.
Yeast    99 DFTDGTGVGGKSIYGDTFPDEN--FTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHV 161

  Fly   154 VFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGE 190
            |||:|::|||.:..|:.|..|.:|.|:|.|.|:.|||
Yeast   162 VFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 78/162 (48%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 78/161 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.