DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CPR8

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:51/184 - (27%)
Similarity:82/184 - (44%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV-----------D 82
            ::.|.:.:::....||..|:|.:.||||..|   |       .||.|...|:.           |
Yeast    55 VFTDPESSEEAGRLITIDLYGTMVPKTVMTF---C-------QYVDSVKDRLASRHSYSPERDFD 109

  Fly    83 RFLVQGGDIVNGDGTGSISI-----YGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTT 142
            :.|..|.  :.|....|.||     .....|:|:.:|.  |:|||.:.|..   |..|.:|.:.|
Yeast   110 KILPNGA--IEGSSVSSSSIEETEMLAPKLPEENHSLI--HDRPGRVSMIK---DDKGLKFIIET 167

  Fly   143 VGAKWLDGKHTVFGKVLEGM-DTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQ 195
            .... |:|:..|||:|..|: |.:..:.:||||.:..|.:|:.|   |.|.:::
Yeast   168 SETP-LEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPITI---GYISSQE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 49/176 (28%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 47/162 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.