DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CPR4

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:85/283 - (30%)
Similarity:132/283 - (46%) Gaps:75/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSL---LNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKK-------------------PVGR- 42
            :|||   |..::||....|.:||..  :||:   ||...||                   ||.: 
Yeast     3 LKSLLLCLYSLVLCQVHAAPSSGKQ--ITSK---DVDLQKKYEPSPPATHRGIITIEYFDPVSKS 62

  Fly    43 -----ITFGLFGKLAPKTVANFRHIC------LRG-----INGTSYVGSRFHRVVDRFLVQGGDI 91
                 :||.|:|.:.||||.||..:.      :.|     |:..||..::.::|.....:||| :
Yeast    63 MKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGG-V 126

  Fly    92 VNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTV--GAKWLDGKHTV 154
            |..| .|..::||..|.||:  ..::|:||..|.||..|||:|..:|.:||.  |.:.||||..|
Yeast   127 VAPD-VGPFTVYGPKFDDEN--FYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNEELDGKSVV 188

  Fly   155 FGKVLEGMDTIY-AIEDVKTDTDD------------FPVEPVVISNCGEIP---TEQFE-FYPDD 202
            ||::..|:|.:. ||:  .|:||:            |.:|.:.|||..::.   ||:.| |...|
Yeast   189 FGQITSGLDQLMDAIQ--YTETDEYGKPQHELRFLYFVLEILKISNILDLHAAYTEKVEKFRNGD 251

  Fly   203 FNILGWIK------AAGLPVTSS 219
            .::...::      .|..|:|:|
Yeast   252 VSVGSTLENIFRNDKAYTPLTTS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 66/212 (31%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 54/157 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.