DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Pnsl5

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_196816.1 Gene:Pnsl5 / 831151 AraportID:AT5G13120 Length:259 Species:Arabidopsis thaliana


Alignment Length:174 Identity:81/174 - (46%)
Similarity:112/174 - (64%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNK---KPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLV 86
            :|.::|.|:....   |..|||..||:|...|:||.|||.:| .|..|..|.||.||||:..|::
plant    88 ITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALC-TGEKGFGYKGSTFHRVIRDFMI 151

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            ||||...|:|||..|:||..|.||:..|:  |..||.|.|||.||:|||.||::.|:...||||:
plant   152 QGGDFEKGNGTGGKSVYGRTFKDENFKLS--HVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGR 214

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQ 195
            |.|||:|:|||:.:..||:.:||..|.|.:.|||::||::|..:
plant   215 HVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPMSE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 77/164 (47%)
Pnsl5NP_196816.1 cyclophilin_ABH_like 90..252 CDD:238907 77/164 (47%)

Return to query results.
Submit another query.