DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ROC1

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:170 Identity:76/170 - (44%)
Similarity:108/170 - (63%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS----YVGSRFHRVVDRFLV 86
            ::|.|:..:.:|.|||...|:....|:|..|||.:|.  :|:.||.    :.||:||||:..|:.
plant     5 KVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNFMC 69

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            ||||...|:|||..||||..|.||:  ...:|..||.|.|||.|.:|||.||::.||...|||||
plant    70 QGGDFTAGNGTGGESIYGSKFEDEN--FERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGK 132

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            |.|||:|:||:|.:.|||.|.:.:.. |.:|||:::||::
plant   133 HVVFGQVVEGLDVVKAIEKVGSSSGK-PTKPVVVADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 74/166 (45%)
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 74/166 (45%)

Return to query results.
Submit another query.