DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and AT4G34960

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:179 Identity:81/179 - (45%)
Similarity:120/179 - (67%) Gaps:8/179 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTS------YVGSRFHRVVDR 83
            :|:|:::||..:.:.:|||..||:|.:.||||.|||.:|......||      |.|:.|||::..
plant    45 ITNRVFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKGTPFHRIISG 109

  Fly    84 FLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWL 148
            |::|||||::|||..|.||||..||||:  ..::|:..|.:.|||.|||:||.||::|||.|.||
plant   110 FVIQGGDIIHGDGKSSDSIYGGTFPDEN--FKIQHSHAGMVAMANTGPDSNGSQFFITTVKASWL 172

  Fly   149 DGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFE 197
            :|:|.|.|||::|||.::|||.........|.:.|||::.||||.::::
plant   173 EGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEIPKDKWD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 76/167 (46%)
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 76/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H60820
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.