DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ROC5

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_195213.1 Gene:ROC5 / 829639 AraportID:AT4G34870 Length:172 Species:Arabidopsis thaliana


Alignment Length:171 Identity:72/171 - (42%)
Similarity:99/171 - (57%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTS-------YVGSRFHRVVDRFL 85
            |::.|:..:..|:|||...||....|.|..|||.:| .|..|..       :.||.||||:..|:
plant     5 RVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALC-TGEKGMGKLGKPLHFKGSIFHRVIPGFM 68

  Fly    86 VQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG 150
            .||||....:|||..||||..|.||:  ...:|...|.|.|||.||:|||.||::.|....||||
plant    69 CQGGDFTAKNGTGGESIYGAKFKDEN--FIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDG 131

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            ||.|||:|::|:|.:.|||.|.:|:.. ..:.|.|::||::
plant   132 KHVVFGQVVKGLDVVKAIEKVGSDSGK-TSKVVTITDCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 70/167 (42%)
ROC5NP_195213.1 cyclophilin_ABH_like 4..169 CDD:238907 70/167 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.