DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and AT4G32420

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001190889.1 Gene:AT4G32420 / 829377 AraportID:AT4G32420 Length:837 Species:Arabidopsis thaliana


Alignment Length:170 Identity:64/170 - (37%)
Similarity:87/170 - (51%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRFL 85
            :::|||..:..|...:.|.||.::||||..|||.:|.  :||...|     |.||.|||::....
plant     8 QVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRIMKGSS 72

  Fly    86 VQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG 150
            .|.||.||.:||...|||...||||...|  .|...|.|.|:....|..|..|::|....:.||.
plant    73 AQAGDFVNRNGTAGESIYAGKFPDESPKL--RHEETGLLSMSIADRDKFGSHFHITFRPNQQLDR 135

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGE 190
            .:.||||:::|.:.:..||.| .|.:..|...|.|..|||
plant   136 NNVVFGKLIQGKEILKKIERV-GDEEGKPTVSVKIIRCGE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 61/167 (37%)
AT4G32420NP_001190889.1 cyclophilin 7..173 CDD:381853 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.