DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ROC4

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001154684.1 Gene:ROC4 / 825376 AraportID:AT3G62030 Length:313 Species:Arabidopsis thaliana


Alignment Length:170 Identity:81/170 - (47%)
Similarity:108/170 - (63%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            ||:::|.||:...:..|||..||||::.||||.|||.:| .|.....|.||.|||::..|::|||
plant   146 VTNKVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALC-TGEKKYGYKGSSFHRIIKDFMIQGG 209

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            |...|:|||.|||||..|.||:  ..::|..||.|.|||.||:|||.||::.||...|||.||.|
plant   210 DFTEGNGTGGISIYGAKFEDEN--FTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVV 272

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTE 194
            ||:|:|||..:..:|..:|...|.|.:...|..|||:|.:
plant   273 FGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPLD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 75/161 (47%)
ROC4NP_001154684.1 cyclophilin_ABH_like 149..307 CDD:238907 75/160 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.