DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and AT3G55920

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:173 Identity:81/173 - (46%)
Similarity:106/173 - (61%) Gaps:9/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS----YVGSRFHRVVDR 83
            ||.::|.|::.|..|.|||..||||.:.|||..|||.:|.  :|:....    :.||.|||::..
plant    57 VTHKVYFDIQINGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKGSSFHRIIPG 121

  Fly    84 FLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWL 148
            |::||||...|||.|..|||||.|.||:  ..::|..||:|.|||.|||:||.||::|||...||
plant   122 FMIQGGDFTRGDGRGGESIYGDKFADEN--FKLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWL 184

  Fly   149 DGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            ||.|.||||||.||:.:..||....|: ..|...|:|...||:
plant   185 DGHHVVFGKVLSGMEVVRKIEAQGQDS-GVPKANVIIFASGEV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 77/167 (46%)
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 77/167 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.