DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and AT2G21130

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_179709.1 Gene:AT2G21130 / 816648 AraportID:AT2G21130 Length:174 Species:Arabidopsis thaliana


Alignment Length:170 Identity:75/170 - (44%)
Similarity:104/170 - (61%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS----YVGSRFHRVVDRFLV 86
            :::.|:.....|.|:|...|:....|||..|||.:|.  :|:..:.    :.||.||||:..|:.
plant     6 KVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMC 70

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            ||||...|:|||..||||..|.||:  ...:|..||.|.|||.|.:|||.||::.||...|||||
plant    71 QGGDFTKGNGTGGESIYGAKFEDEN--FERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGK 133

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            |.|||:|:||:|.:.|||.:.:.:.. |.:||||::||||
plant   134 HVVFGQVVEGLDVVKAIEKIGSSSGK-PTKPVVIADCGEI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 71/166 (43%)
AT2G21130NP_179709.1 cyclophilin_ABH_like 5..170 CDD:238907 71/166 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.