DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ROC3

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001318231.1 Gene:ROC3 / 816161 AraportID:AT2G16600 Length:173 Species:Arabidopsis thaliana


Alignment Length:170 Identity:76/170 - (44%)
Similarity:102/170 - (60%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS----YVGSRFHRVVDRFLV 86
            ::|.|:....|..|||...|:....|:|..|||.:|.  |||....    |.||.||||:.:|:.
plant     6 KVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPKFMC 70

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            ||||...|:|||..||||..|.||:  ...:|..||.|.|||.|.:|||.||::.|....|||||
plant    71 QGGDFTAGNGTGGESIYGSKFKDEN--FIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGK 133

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            |.|||:|:||::.:..||.|.:|:.. ..:||||::||:|
plant   134 HVVFGQVVEGLNVVRDIEKVGSDSGR-TSKPVVIADCGQI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 73/166 (44%)
ROC3NP_001318231.1 cyclophilin_ABH_like 5..170 CDD:238907 73/166 (44%)

Return to query results.
Submit another query.