DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and SQN

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:218 Identity:88/218 - (40%)
Similarity:118/218 - (54%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRF 84
            |:.:||:....:..|||...|:..:.|||..|||.:|.  :|:...:     |.|:|||||:..|
plant     4 SKCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGF 68

  Fly    85 LVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLD 149
            ::|||||...||||..||||..|.||:  ..::|.|.|.|.|||.||:|||.||::||.....||
plant    69 MIQGGDISANDGTGGESIYGLKFDDEN--FELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLD 131

  Fly   150 GKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPT----------EQFEFYPD--- 201
            |||.|||:|.:||..:.:||.|..:....|.:.|||.:|||||.          :..:.|||   
plant   132 GKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIPEGADDGICDFFKDGDVYPDWPI 196

  Fly   202 DFN----ILGW-------IKAAG 213
            |.|    .|.|       :||.|
plant   197 DLNESPAELSWWMETVDFVKAHG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 73/168 (43%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 73/168 (43%)
TPR_11 216..329 CDD:290150 3/4 (75%)
TPR repeat 263..293 CDD:276809
TPR_2 298..331 CDD:285020
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.