DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppil2

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001039036.2 Gene:ppil2 / 733789 XenbaseID:XB-GENE-855860 Length:521 Species:Xenopus tropicalis


Alignment Length:164 Identity:67/164 - (40%)
Similarity:91/164 - (55%) Gaps:10/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            |..:.|:.:..||   |.:...|:....|||..||..:|.:..    |.|:.|||.:..|::|||
 Frog   276 VKKKGYVRLHTNK---GDLNLELYCDKTPKTCENFVKLCKKNY----YDGTIFHRSIRNFVIQGG 333

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            | ..|.|||..|.:|..|.||.|. .:.|...|.|.|||.||:||..||::|.....:||.||||
 Frog   334 D-PTGTGTGGESFWGKPFKDELKP-NLSHTGRGVLSMANTGPNTNKSQFFITFRSCTYLDRKHTV 396

  Fly   155 FGKVLEGMDTIYAIEDVKTDT-DDFPVEPVVISN 187
            ||:|:.|.||:.|:|:|.||| .|.|.|.:.|.:
 Frog   397 FGRVVGGFDTLTAMENVDTDTKTDRPKEEIRIES 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 66/162 (41%)
ppil2NP_001039036.2 RING-Ubox_PPIL2 38..110 CDD:438325
RING_Ubox 100..159 CDD:473075
cyclophilin_RING 281..440 CDD:238904 66/159 (42%)
Selenoprotein_S <439..>506 CDD:462043
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.