DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppil1

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:111 Identity:22/111 - (19%)
Similarity:46/111 - (41%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PGMGPGTVAGVSGPAQRARARTGTFSKSP---ERYAGKRIDSEGNMVVSNGSSAKGTPLKDRENW 164
            |...|..:..|.|..:.:........:.|   ::|. |..:||||......:.|...|:..::. 
Mouse   907 PAKSPCILPIVHGGVKASSTHYYLLPEKPAYLDKYE-KFFNSEGNDEKRTTNMATVRPMVQQQG- 969

  Fly   165 NPNDGRLNHTADKRSRANSATQRPTGAKRSLLMNTSAGAIQQLPHG 210
            |.::...:||::  |..:|:...|:.::.......:...:|:..||
Mouse   970 NKSNASPSHTSN--SGTSSSLAWPSSSQAGSYSRVTLQQVQEAVHG 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 18/88 (20%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.