DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppib

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:171 Identity:91/171 - (53%)
Similarity:119/171 - (69%) Gaps:3/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            ||.::|.|.:...:||||:|||||||..||||.||..:. .|..|..|..|:||||:..|::|||
  Rat    34 VTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALA-TGEKGFGYKNSKFHRVIKDFMIQGG 97

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            |...|||||..||||:.||||:  ..::|..||::.|||.|.||||.||::|||...||||||.|
  Rat    98 DFTRGDGTGGKSIYGERFPDEN--FKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVV 160

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQ 195
            |||||||||.:..:|:.|||:.|.|::.|:|.:||:|..|:
  Rat   161 FGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEVEK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 85/161 (53%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 85/160 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.