DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppifb

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:195 Identity:83/195 - (42%)
Similarity:119/195 - (61%) Gaps:8/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLLNRIILCS-AFLAV---ASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRH 61
            |..|.||:.||| ||.|.   ::|:.......::.|:..:.:|:||:||.|...:.|||..|||.
Zfish     1 MLILGNRLKLCSVAFTAARLYSTGVQANNNPVVFFDIAADNQPLGRVTFELNADVVPKTAENFRA 65

  Fly    62 ICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGM 126
            :| .|.:|..|.||.||||:.:|:.||||..|.:|||..||||..||||:  ..::|..||.|.|
Zfish    66 LC-TGEHGFGYKGSIFHRVIPQFMCQGGDFTNHNGTGGKSIYGPRFPDEN--FKLKHTGPGILSM 127

  Fly   127 ANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            ||.|.:|||.||::.|...:||||:|.|||.|.||||.:..:|.:.:.:.. ..:.:.|::|||:
Zfish   128 ANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVKEGMDVVRKVEALGSRSGR-TAQRISITDCGEL 191

  Fly   192  191
            Zfish   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 69/161 (43%)
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 69/161 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.