DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppie

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:163 Identity:75/163 - (46%)
Similarity:100/163 - (61%) Gaps:4/163 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIV 92
            ::|||:|...||.|||...|...:.|.|..|||.:|... .|..:.||.|||::.:|:.||||..
Mouse   141 QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE-KGFGFKGSSFHRIIPQFMCQGGDFT 204

  Fly    93 NGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGK 157
            |.:|||..||||..|.||:  ..::|..||.|.|||.||:|||.||::|.....||||||.|||:
Mouse   205 NHNGTGGKSIYGKKFDDEN--FILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGE 267

  Fly   158 VLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGE 190
            |.||:|.:..|| .:...|..|.:.|:|::|||
Mouse   268 VTEGLDVLRQIE-AQGSKDGKPKQKVMIADCGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 72/160 (45%)
PpieNP_062362.1 RRM <5..194 CDD:223796 22/53 (42%)
RRM_PPIE 8..80 CDD:240793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141 75/163 (46%)
cyclophilin_ABH_like 140..298 CDD:238907 72/160 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.