DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppil1

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:146 Identity:62/146 - (42%)
Similarity:86/146 - (58%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYG 104
            :|.|...|:...||||..||..:..||.    |..::|||::..|:||||| ..|.|.|..||||
Zfish    20 MGTIVLELYWNHAPKTCKNFAELGRRGY----YNSTKFHRIIKDFMVQGGD-PTGTGRGGASIYG 79

  Fly   105 DYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169
            ..|.||... .::....|.|.|||.||||||.||:::....:|||||||:||:|.:|:..:..|.
Zfish    80 KQFEDEFHP-ELKFTGAGILAMANAGPDTNGSQFFLSLAPTQWLDGKHTIFGRVCQGIGVLNRIG 143

  Fly   170 DVKTDTDDFPVEPVVI 185
            .|:|::.|.||:.:.|
Zfish   144 MVETNSQDRPVDDIKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 62/146 (42%)
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 62/146 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.