DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and PPIL3

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens


Alignment Length:93 Identity:37/93 - (39%)
Similarity:56/93 - (60%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLE 160
            |.|..||:|..|.||.... ::||..|.:.|||.||:|||.||::|......||.|:||||||::
Human    64 GRGGNSIWGKKFEDEYSEY-LKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVID 127

  Fly   161 GMDTIYAIEDVKTDTDDF-PVEPVVISN 187
            |::|:..:|.:..:...: |:..|.|.:
Human   128 GLETLDELEKLPVNEKTYRPLNDVHIKD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 37/93 (40%)
PPIL3NP_115861.1 cyclophilin 1..158 CDD:294131 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.