DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and NKTR

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001336053.1 Gene:NKTR / 4820 HGNCID:7833 Length:1463 Species:Homo sapiens


Alignment Length:175 Identity:78/175 - (44%)
Similarity:106/175 - (60%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRFLVQ 87
            :.|::.|::|||||.|.||..:.|||..||..:|.  :|:..|:     |.||.|||||..|::|
Human    10 HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQ 74

  Fly    88 GGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKH 152
            |||...|:|.|..||||.||.||:  ..::|:|...|.|||||..|||.||::||..|..|||.|
Human    75 GGDFSEGNGKGGESIYGGYFKDEN--FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVH 137

  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFE 197
            .|||.|:.|.:.|..||::|||....|...|.:.:||.:.|:..:
Human   138 VVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKSIK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 75/165 (45%)
NKTRNP_001336053.1 cyclophilin 7..174 CDD:320812 75/165 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..1072
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1129..1156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1169..1215
Arg/Ser tandem repeat-rich 1311..1348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.