DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Moca-cyp

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:171 Identity:75/171 - (43%)
Similarity:101/171 - (59%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RG---ING--TSYVGSRFHRVVDRFL 85
            |.:.|:......:|||.|.||..:||||..|||.:|.  :|   |.|  ..|.|..|||||..|:
  Fly    14 RCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFM 78

  Fly    86 VQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG 150
            ||.||...|:|||..||||..|  ||::...:|:||..|.|||||.:|||.||::||..|..||.
  Fly    79 VQAGDFSAGNGTGGESIYGGTF--EDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDN 141

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            .|.|||:|:.|.:.:..:|.:..|.:..|::...|:||||:
  Fly   142 IHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 72/167 (43%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 72/167 (43%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.