DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG5808

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:163 Identity:46/163 - (28%)
Similarity:73/163 - (44%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHIC-LRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIY 103
            :|.:|..||....|....||..:| |:     .|..:.||.|...|:.|.|| .:|.|.|..||:
  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLK-----YYNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIW 67

  Fly   104 G------------DYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKW--LDGKHTV 154
            |            ::.|      .:.|:..|.|.:.:.|.:..|.||:: |:|...  |||.|.|
  Fly    68 GVVEGPQKRFFEAEFLP------KINHSSAGMLSLVSAGKNLVGSQFFL-TLGENLTSLDGNHCV 125

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISN 187
            .|:|:||.:.:..:.|...|....|.:.:.|::
  Fly   126 IGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 46/163 (28%)
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 46/163 (28%)
RRM_PPIL4 237..319 CDD:409681
PRK12678 344..>510 CDD:237171
U2AF_lg 467..>572 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.