DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG5808

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:163 Identity:46/163 - (28%)
Similarity:73/163 - (44%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHIC-LRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIY 103
            :|.:|..||....|....||..:| |:     .|..:.||.|...|:.|.|| .:|.|.|..||:
  Fly     9 MGDLTVDLFISERPIACLNFLKLCRLK-----YYNFNLFHTVQQGFIAQTGD-PSGAGDGGSSIW 67

  Fly   104 G------------DYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKW--LDGKHTV 154
            |            ::.|      .:.|:..|.|.:.:.|.:..|.||:: |:|...  |||.|.|
  Fly    68 GVVEGPQKRFFEAEFLP------KINHSSAGMLSLVSAGKNLVGSQFFL-TLGENLTSLDGNHCV 125

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISN 187
            .|:|:||.:.:..:.|...|....|.:.:.|::
  Fly   126 IGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 46/163 (28%)
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 46/163 (28%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.