DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppig

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_998629.1 Gene:ppig / 406773 ZFINID:ZDB-GENE-040426-2822 Length:687 Species:Danio rerio


Alignment Length:171 Identity:75/171 - (43%)
Similarity:102/171 - (59%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRFL 85
            |.:.|:..:..|.||:...||..:.|||..|||.:|.  :|:..|:     |.|:.|||:|..|:
Zfish     9 RCFFDIGISNVPAGRVVIELFSDVCPKTCENFRCLCTGEKGVGKTTQKPLHYKGTPFHRIVKDFM 73

  Fly    86 VQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG 150
            :||||...|:|.|..||||.:|  ||.:.:::|.:...|.|||||.||||.||::||.....|||
Zfish    74 IQGGDFSEGNGRGGESIYGGFF--EDGSFSMKHTKEFLLSMANRGKDTNGSQFFITTKPTPHLDG 136

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            .|.|||:|:.|.|.|..||..||||:..|...|.:.||||:
Zfish   137 IHVVFGQVITGQDVIRMIESQKTDTNSRPYAEVKVLNCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 72/167 (43%)
ppigNP_998629.1 cyclophilin 8..175 CDD:469651 72/167 (43%)
PRK12678 430..>644 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.