DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppib

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_998184.1 Gene:ppib / 406292 ZFINID:ZDB-GENE-040426-1955 Length:216 Species:Danio rerio


Alignment Length:171 Identity:90/171 - (52%)
Similarity:113/171 - (66%) Gaps:3/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            ||:::|.|:|...:..|||..|||||..|||..||..:. .|..|..|.||:||||:..|::|||
Zfish    42 VTAKVYFDIKIGDEDAGRIVIGLFGKTVPKTTENFLQLA-TGEKGFGYKGSKFHRVIKDFMIQGG 105

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            |...|||||..|||||.||||:  ..::|..||:|.|||.|.||||.||::|||...||||||.|
Zfish   106 DFTRGDGTGGKSIYGDRFPDEN--FKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVV 168

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQ 195
            |||:|||||.:..||..|||..|.|::.|.|.:.|:|..|:
Zfish   169 FGKILEGMDVVRKIEATKTDGRDKPLKDVSIHDSGKIDVEK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 85/161 (53%)
ppibNP_998184.1 cyclophilin_ABH_like 45..203 CDD:238907 85/160 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.