DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG7768

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:169 Identity:75/169 - (44%)
Similarity:98/169 - (57%) Gaps:14/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIV 92
            |:|.|:....:.:|||...|...:.|||..|||.:| .|..|..|.||.||||:..|:.||||..
  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALC-TGEKGYGYKGSPFHRVIPNFMCQGGDFT 68

  Fly    93 NGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGK 157
            |.:|||..||||:.||||:  ..::|...|.|.|||.|.:|||.||::.|....|||.||.||||
  Fly    69 NQNGTGGRSIYGNKFPDEN--FELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGK 131

  Fly   158 VLEGMDTI-----YAIEDVKTDTDDFPVEPVVISNCGEI 191
            |:||||.:     |..:|.||.      :.|:|.:||.:
  Fly   132 VVEGMDIVQKVESYGSQDGKTS------KKVIIEDCGAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 73/165 (44%)
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 73/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.