DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppih

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_989366.1 Gene:ppih / 394997 XenbaseID:XB-GENE-485863 Length:177 Species:Xenopus tropicalis


Alignment Length:168 Identity:79/168 - (47%)
Similarity:103/168 - (61%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL-----RGINGTSYVGSRFHRVVDRFLVQG 88
            ::.|:....:.|||:...||..:.|||..|||..|.     .|: ...|.||.||||:..|::||
 Frog    13 VFFDISIGGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGV-PIGYKGSTFHRVIKDFMIQG 76

  Fly    89 GDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHT 153
            ||.|||||||..|||...|.||:  ...:|:.||.|.|||.||.||||||::|.....||||||.
 Frog    77 GDFVNGDGTGVASIYRGPFADEN--FKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDGKHV 139

  Fly   154 VFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            |||||::|:..:..||:|.|..::.|..||||:.|||:
 Frog   140 VFGKVIDGLLVMRKIENVPTGPNNKPKLPVVIAQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 76/164 (46%)
ppihNP_989366.1 cyclophilin 5..177 CDD:381853 78/166 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.