DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppid

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_988984.1 Gene:ppid / 394581 XenbaseID:XB-GENE-855598 Length:370 Species:Xenopus tropicalis


Alignment Length:171 Identity:71/171 - (41%)
Similarity:107/171 - (62%) Gaps:10/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRFL 85
            ::::||:...:.||||...||..:.|||..|||.:..  :||..::     :.|..|||::.:|:
 Frog    17 KVFLDVEIGGERVGRIVLELFADVVPKTAENFRALSTGEKGIGQSTGKPLHFKGCPFHRIIKKFM 81

  Fly    86 VQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDG 150
            :|.||..|.:|||..||||:.|.||:  ...:|::.|.|.|||.||:|||.||::|||....|||
 Frog    82 IQCGDFSNQNGTGGESIYGEKFEDEN--FHYKHDKEGLLSMANAGPNTNGSQFFITTVPTAHLDG 144

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            ||.|||:||:|...:..:|:|:. .|:.|.:..||:.|||:
 Frog   145 KHVVFGQVLKGYGIVKMLENVEV-KDEKPAKMCVIAECGEL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 68/167 (41%)
ppidNP_988984.1 cyclophilin_ABH_like 16..182 CDD:238907 68/167 (41%)
3a0801s09 192..>362 CDD:273380
TPR repeat 223..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.