DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG8336

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:245 Identity:81/245 - (33%)
Similarity:122/245 - (49%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLR--GINGT-----SYVGSRFHRVVDRFLV 86
            :|:|:...|:..||:...|...:.|||..|||.:|..  || ||     .|.|::||::...|:|
  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGI-GTLGKPLHYKGTKFHKIKRVFVV 80

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRG-PDTNGCQFYVTTVGAKWLDG 150
            |.||:|..||:...||||..|.||:..|:  ||..|.:.|||.| |::|..||:::..|.:.|:|
  Fly    81 QSGDVVKNDGSSGESIYGPVFDDENFELS--HNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143

  Fly   151 KHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI-------------PTEQFEFYPDD 202
            .:.|.|:||.|:..:..:|...||..| |..|:||.:||||             .|::...||.|
  Fly   144 TNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAYPQD 207

  Fly   203 F-------------NILGWIKAAGLPVTSSFCVLLIFHYF---FRQLNMY 236
            :             .:|..|:.:|    :.|..|..:|..   :|:.|.|
  Fly   208 WPRKLDKFTGDGAVELLTGIRQSG----NHFYQLGRYHEARAKYRKANRY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 64/167 (38%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 64/167 (38%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.