DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Cypl

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster


Alignment Length:149 Identity:68/149 - (45%)
Similarity:87/149 - (58%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYG 104
            :|.||..|:.|.||.|..||..:..||.    |....|||::..|::|||| ..|.|.|..||||
  Fly    29 MGEITVELYWKHAPNTCRNFAELSRRGY----YNNVVFHRIIRDFMIQGGD-PTGTGRGGASIYG 88

  Fly   105 DYFPDE---DKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIY 166
            ..|.||   |    :.|...|.|.|||.||||||.||::|....:|||||||:||:|..||:.:.
  Fly    89 SEFADELHGD----LRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVK 149

  Fly   167 AIEDVKTDTDDFPVEPVVI 185
            .|..|:||.:|.||:|:.|
  Fly   150 RIGMVETDKNDRPVDPLRI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 68/149 (46%)
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 68/149 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2633
65.860

Return to query results.
Submit another query.