DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG3492

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster


Alignment Length:183 Identity:44/183 - (24%)
Similarity:75/183 - (40%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPV-GRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDI 91
            :||:|::..:..: ||:...||.:..|:.|..|..||.:. |.::.|   |:|.:....::|...
  Fly   247 QIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQN-NSSAIV---FNRALAPIWMEGRLA 307

  Fly    92 VNGDGTGSISIYGDYFPDEDKALA-VEHNRPGYLGMANRGPDTNGCQF---YVT---------TV 143
            ::              |.....|. :||:    ..:.|.|.|.....|   ||.         |:
  Fly   308 MD--------------PQRSTELTNIEHD----FEVLNHGVDAGILSFPSRYVRGNARTAVNFTI 354

  Fly   144 GAK---WLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVIS--NCGEI 191
            ..|   .|:|:...||||.:||.   .:|.::......|:...:||  :||.|
  Fly   355 SFKPLSILNGRRIAFGKVRKGMQ---LLERIQVAVGHLPMSHNLISLTDCGVI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 41/179 (23%)
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.