DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyp33

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:166 Identity:68/166 - (40%)
Similarity:93/166 - (56%) Gaps:8/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIV 92
            :::.|::......|||...|...:.|||..|||.:|... .|..|.|..||||:..|:.||||..
  Fly   140 QVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHE-QGYGYKGCSFHRVIPEFMCQGGDFT 203

  Fly    93 NGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGK 157
            |.:|||..||||..|.||:  ..::||..|.|.|||.|.:|||.||::.|....|||.||.|||.
  Fly   204 NNNGTGGKSIYGKKFNDEN--FNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGH 266

  Fly   158 VLEGMDTIYAIE--DVKTDTDDFPVEPVVISNCGEI 191
            |:.|.:.:..:|  ..|:.|   |.:.:||.:|||:
  Fly   267 VISGAEVVRKMERCGSKSGT---PSQKIVIYSCGEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 65/162 (40%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 65/162 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.