DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and CG7747

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:195 Identity:73/195 - (37%)
Similarity:100/195 - (51%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVASGLSFTVTSRI----------------YMDVKHNKK-------PVGRITFGLFGKLAPKTVA 57
            |||:  |||.|:.:                |..||  ||       .:|.:...||....|:...
  Fly   245 AVAA--SFTSTAMVPVSQIEAAIIDDDLVKYERVK--KKGYVRLNTNLGPLNLELFCDQTPRACD 305

  Fly    58 NFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPG 122
            ||...|..|.    |....|||.:..|:||||| ..|.|:|..||:|..|.||.|. .:.|...|
  Fly   306 NFIKHCANGY----YNNVMFHRSIRNFIVQGGD-PTGSGSGGESIWGKKFEDEFKP-NLTHTGRG 364

  Fly   123 YLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISN 187
            .|.|||.||:|||.||::|....|.||||||:|||::.|:||:..:|:::.|..|.|:|.::|.:
  Fly   365 VLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIES 429

  Fly   188  187
              Fly   430  429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 66/184 (36%)
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 61/155 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.