DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Cwc27

DIOPT Version :10

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:155 Identity:65/155 - (41%)
Similarity:82/155 - (52%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSIS 101
            |...|.|...|:.|.|||...||..:||...    |..:.|||||..|:||||| ..|.|||..|
  Rat    18 KTTAGDIDIELWSKEAPKACRNFIQLCLEAY----YDNTIFHRVVPGFIVQGGD-PTGTGTGGES 77

  Fly   102 IYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIY 166
            :||..|.||..: .:..||.|.:.|||.||..||.||:.|...|..|:.|||:||||..  ||:|
  Rat    78 VYGAPFKDEFHS-RLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTG--DTVY 139

  Fly   167 ---AIEDVKTDTDDFPVEPVVISNC 188
               .:.:|..|.::.|..|..|.:|
  Rat   140 NMLRLTEVDIDDEERPRNPHRIKSC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 65/155 (42%)
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906 65/155 (42%)
PTZ00121 <278..>467 CDD:173412
CWC27_CTD 376..427 CDD:412084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.