DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppil4

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001381983.1 Gene:Ppil4 / 361449 RGDID:1311051 Length:492 Species:Rattus norvegicus


Alignment Length:169 Identity:56/169 - (33%)
Similarity:83/169 - (49%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYG 104
            :|.:...|:.:..|:...||..:|  .|...:|  ...|.|...|::|.|| ..|.|.|..||:|
  Rat     9 LGDVVIDLYTEERPRACLNFLKLC--KIKYYNY--CLIHNVQRDFIIQTGD-PTGTGRGGESIFG 68

  Fly   105 DYFPDE------DKALAVEHNRPGYLGMANRGPDTNGCQFYVTT-VGAKWLDGKHTVFGKVLEGM 162
            ..:.|:      :|...::|.:.|.:.|.|.|.|.:|.||.:|| ....:|||.|||||:|.|||
  Rat    69 QLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGM 133

  Fly   163 DTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYPD 201
            |.:..|.:...|.|..|.:.:.| |...|..:.|:..||
  Rat   134 DIVKKINETFVDKDFVPYQDIRI-NHTVILDDPFDDPPD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 52/155 (34%)
Ppil4NP_001381983.1 cyclophilin_RRM 4..161 CDD:238902 52/157 (33%)
RRM_PPIL4 237..319 CDD:409681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.